PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_44263g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 483aa    MW: 52922 Da    PI: 7.5359
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_44263g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.63.2e-1479124448
                      S-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 
                      W++eEd +l +++k++G   +W+ +a+  g+ R++k+c++rw +yl
    MA_44263g0010  79 WSPEEDHKLTNYIKKHGLLsCWSYVAKQAGLQRCGKSCRLRWINYL 124
                      *****************88*************************97 PP

2Myb_DNA-binding42.51.5e-13130173146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++  E+ l+v++   lG++ W+ Ia +++ gRt++++k++w++
    MA_44263g0010 130 RGAFSIHEERLIVHLQSILGNR-WSQIATHLP-GRTDNEIKNFWNS 173
                      899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.571124IPR017930Myb domain
SuperFamilySSF466891.17E-2575171IPR009057Homeodomain-like
SMARTSM007171.3E-775126IPR001005SANT/Myb domain
PfamPF002493.4E-1278124IPR001005SANT/Myb domain
CDDcd001672.90E-879124No hitNo description
Gene3DG3DSA:1.10.10.605.8E-2279131IPR009057Homeodomain-like
PROSITE profilePS5129423.356125179IPR017930Myb domain
SMARTSM007175.9E-12129177IPR001005SANT/Myb domain
PfamPF002493.0E-11130173IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-22132179IPR009057Homeodomain-like
CDDcd001675.85E-9137172No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
MNEWTTSQHE AHVVDGASSL MPSQGRLNSW FYRFRAELST GLGALRVAKM SCTQGLGLGK  60
GDHGGHPTSS KQKPRKCLWS PEEDHKLTNY IKKHGLLSCW SYVAKQAGLQ RCGKSCRLRW  120
INYLRPGLKR GAFSIHEERL IVHLQSILGN RWSQIATHLP GRTDNEIKNF WNSCIKKKLM  180
LQHQLPSTSS TTTKGNTKSN IPSQSSLVCN TNSVSANAHA QDAFASYHSH GLDQNAEFPV  240
DPNPINNQLI SYSQLWINAA SAHTHGSFSG HADFTSPTLL AQNLNTHKAA KPSTCDQLII  300
ESCRNIVPRP EAPASADYSL VSNGITIPAL VERHIESDGQ MNEDEIYSSF TASSGINAWS  360
TGHSYSNIAA GFSDVNPGVY STTHDHELLG ITILEDHMDR HKSYQLPHIQ GGEEGSGDQL  420
GCSRISNQEA NSKPIPVIFG GSGPLEIQDC NGGGRQVTVW AHGDMYNINS TAASDLFHQI  480
YLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-257917910108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1150080.0BT115008.1 Picea glauca clone GQ03607_C13 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA5JYE84e-71A5JYE8_PICGL; R2R3-MYB transcription factor MYB4
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.11e-54myb domain protein 50